Myllyn Paras mansikka-raparperilevypiirakka 14palaa/1,25kg kypsä, pakaste
6417700169113
Oy Lantmännen Unibake Ab
Sales unit
ST
Sales amount:
3
ST
VAT %:
13.5%
Delivery & availability
Product type:
Order product
If you want to buy order products in smaller quantities, please contact your C&C manager or sales manager
Juicy strawberry-rhubarb-filled sheet pie. There are three sheets in the sale lot, each disc is already cut into 21 pieces.
Ingredients
WHEAT FLOUR, sugar, vegetable oil (rapeseed, coconut), strawberry 14% (EU), rhubarb 14 % (EU), water, glucose syrup, WHEAT STARCH, whole EGG powder, EGG WHITE powder, raising agents (E450, E500), stabilizer (E466), salt, flour improver (E300), emulsifier (E471), color (E160a), flavor. May contain traces of almonds, milk.
Origin of product
| Country of manufacture | Finland  |
| Genetically modified code | Free from  |
Origin of ingredients
| Strawberry |
Percentage of ingredient : 14 
Rearing : European Union  |
| Rhubarb |
Percentage of ingredient : 14 
Rearing : European Union  |
Nutritional properties
| Contains allergen(s) |
Eggs and their derivatives in the product 
Wheat and its derivatives  Cereals containing gluten and its derivatives  |
| May contain allergen(s) |
Almond and almond products 
Milk and its derivatives  Tree nuts and its derivatives  |
| Free From | Lactose  |
| Energy content (kJ) | 1478  kJ |
| Energy content (kcal) | 353  kcal |
| fat, total | 19  g |
| fatty acids, total saturated | 3.3  g |
| Carbohydrates | 43  g |
| fibre | 1.7  g |
| Protein | 4.2  g |
| Salt | 0.6  g |
| Carbohydrates of which lact. | 0  g |
| Additive Name |
E160a Carotenes 
E450 Diphosphates  E466 Carboxy methyl cellulose, Sodium carboxy methyl cellulose  E500 Sodium Carbonates  E300 Ascorbic acid  E471 Mono- and diglycerides of fatty acids  |
| Brand Name | Myllyn Paras |
| Packaging label | Made in Finland Flag with Key |
| Storage type | Frozen goods |
| Packaging type code | Bag |
| Handling Instructions Code Reference |
Frozen product
Foodstuffs |
| Preparation instructions (Fin) | Sulata 2 h huoneenlämmössä tai yön yli kylmiössä. |
| Preparation instructions (Swe) | Tina 2 h i rumstemperatur eller över natten i kyl. |
| Consumer storage instructions (fin) | Pakaste. Säilytetään -18°C tai alle. Sulanutta tuotetta ei saa jäädyttää uudelleen. Sulatetut tuotteet säilytettävä viileässä ja suositellaan kulutettavan 5 vrk kuluessa. |
| Consumer storage instructions (swe) | Djupfryst. Förvaras vid -18 °C eller kallare. Får inte frysas efter upptining. Upptinade produkter ska förvaras i kall temperatur och rekommenderas att konsumeras inom 5 dagar. |
| Consumer storage instructions (eng) | Frozen. Storage at -18°C or colder. Do not refreeze after defrosting. Thawed products to be stored at cool temperature and recommended to be consumed within 5 days. |
| Minimum storage handling temperature | -25 °C |
| Maximum storage handling temperature | -18 °C |
| Opened item lifespan (days) | 5 pv |





